PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00047889001
Common NameGSBRNA2T00047889001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family Dof
Protein Properties Length: 259aa    MW: 27910.9 Da    PI: 8.7838
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00047889001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof126.58.3e-4053111462
               zf-Dof   4 kalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                           al+cprCdstntkfCyynnyslsqPryfCk+CrryWtkGG+lrn+PvGgg+rknk+s+
  GSBRNA2T00047889001  53 LALRCPRCDSTNTKFCYYNNYSLSQPRYFCKSCRRYWTKGGTLRNIPVGGGCRKNKRST 111
                          5789****************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-3048108IPR003851Zinc finger, Dof-type
PfamPF027015.7E-3454109IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.51655109IPR003851Zinc finger, Dof-type
PROSITE patternPS0136105793IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 259 aa     Download sequence    Send to blast
MDHLLQHQDV FSNYNKARDA MGVSSSPNPT EVDHNQKKPS PATGAAKPQP PDLALRCPRC  60
DSTNTKFCYY NNYSLSQPRY FCKSCRRYWT KGGTLRNIPV GGGCRKNKRS TSSATRSLRT  120
TPEPAFSAAS FGGFGNNEHT DLSLAFALLN KQPQGSSSHL GFPSAFGNSS SHQSDMESVF  180
GTSQKNENAG YAFGNGSSGL DMAMSDPNKV LWGFPWQMNG EGFGMMSMGG GGGGHVDQVD  240
SGRELWTNMN YINSGALM*
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00047889001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2347371e-119AC234737.1 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrH010D15, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009120539.10.0PREDICTED: dof zinc finger protein DOF5.3
SwissprotQ84TE91e-149DOF53_ARATH; Dof zinc finger protein DOF5.3
TrEMBLA0A078H4250.0A0A078H425_BRANA; BnaA10g13030D protein
STRINGBra002504.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM61321845
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60200.11e-132TARGET OF MONOPTEROS 6
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]